PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 312aa    MW: 34403.3 Da    PI: 7.7465
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619750.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.52.4e-4391081100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfa+vhk+FGasnv kll++l  ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+ql+++l+
  XP_013619750.1   9 PCAACKFLRRKCTQECVFAPYFPPDQPHKFAYVHKIFGASNVAKLLNDLASNQREDAVNSLFYEAEARLRDPVYGCVGLISILQHRLKQLQHDLD 103
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      +k+e
  XP_013619750.1 104 NAKKE 108
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381557.5E-886305IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089127.0598109IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-429106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MASSSSSSPC AACKFLRRKC TQECVFAPYF PPDQPHKFAY VHKIFGASNV AKLLNDLASN  60
QREDAVNSLF YEAEARLRDP VYGCVGLISI LQHRLKQLQH DLDNAKKELA AYAAPNAMLP  120
MHHPQPHFMS LPPQPQRPSS ASSSASVLTQ QQQHHNLLPV LAIPTEQLLY HQQHIFEAQQ  180
LAAVNSVSRD QLNEMFRAYG GGSNSPHHHH NQPQFDILRF NSGFGSVPTG SVTVTGFNQL  240
SSSGTTITGM SPSLALGDSF VDSPSTNDNY HRDQQLQHQQ SSQPLPLQTQ ETQTRPNSKS  300
EEGRGNIIGS SR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619750.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_013675465.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_013727476.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ31e-143LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A078IG080.0A0A078IG08_BRANA; BnaC02g44040D protein
TrEMBLA0A0D3AYV30.0A0A0D3AYV3_BRAOL; Uncharacterized protein
STRINGBra012112.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-115ASYMMETRIC LEAVES 2-like 1